NECAB3 Recombinant Protein Antigen

Images

 
There are currently no images for NECAB3 Recombinant Protein Antigen (NBP2-68902PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NECAB3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NECAB3.

Source: E. coli

Amino Acid Sequence: SSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NECAB3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68902.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NECAB3 Recombinant Protein Antigen

  • Amyloid beta A4 protein-binding family A member 2-binding protein
  • APBA2BPfamily A, member 2 binding protein
  • dJ63M2.4
  • dJ63M2.5
  • EFCBP3STIP3
  • EF-hand calcium binding protein 3
  • Neuronal calcium-binding protein 3
  • neuronal calcium-binding protein NECAB3
  • NIP1Nek2-interacting protein 1
  • N-terminal EF-hand calcium binding protein 3
  • N-terminal EF-hand calcium-binding protein 3
  • synaptotagmin interacting protein 2
  • synaptotagmin interacting protein STIP3
  • SYTIP2
  • XB51X11L-binding protein 51

Background

NECAB3 is encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61762
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-00702
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-93302
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-18891
Species: Hu, Mu
Applications: IP, WB
NBP1-77683
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-30725
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-511
Species: Hu, Mu
Applications: IP, WB
NBP2-75515
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF,  IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP1-84004
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-41182
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
H00004751-M11
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-48674
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP1-84002
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-93521
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-68902PEP
Species: Hu
Applications: AC

Publications for NECAB3 Recombinant Protein Antigen (NBP2-68902PEP) (0)

There are no publications for NECAB3 Recombinant Protein Antigen (NBP2-68902PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NECAB3 Recombinant Protein Antigen (NBP2-68902PEP) (0)

There are no reviews for NECAB3 Recombinant Protein Antigen (NBP2-68902PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NECAB3 Recombinant Protein Antigen (NBP2-68902PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NECAB3 Products

Research Areas for NECAB3 Recombinant Protein Antigen (NBP2-68902PEP)

Find related products by research area.

Blogs on NECAB3

There are no specific blogs for NECAB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NECAB3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NECAB3