NDUFB7 Antibody

Images

 
Western Blot: NDUFB7 Antibody [H00004713-B01P] - Analysis of NDUFB7 expression in K-562.
Western Blot: NDUFB7 Antibody [H00004713-B01P] - Analysis of NDUFB7 expression in transfected 293T cell line by NDUFB7 polyclonal antibody. Lane 1: NDUFB7 transfected lysate(15.07 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NDUFB7 Antibody Summary

Immunogen
NDUFB7 (NP_004137.2, 1 a.a. - 137 a.a.) full-length human protein. MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NDUFB7
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFB7 Antibody

  • B18
  • Cell adhesion protein SQM1
  • CI-B18NADH-ubiquinone oxidoreductase B18 subunit
  • complex I B18 subunit
  • Complex I-B18
  • MGC2480
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7 (18kD, B18)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA

Publications for NDUFB7 Antibody (H00004713-B01P) (0)

There are no publications for NDUFB7 Antibody (H00004713-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB7 Antibody (H00004713-B01P) (0)

There are no reviews for NDUFB7 Antibody (H00004713-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFB7 Antibody (H00004713-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFB7 Products

Bioinformatics Tool for NDUFB7 Antibody (H00004713-B01P)

Discover related pathways, diseases and genes to NDUFB7 Antibody (H00004713-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB7 Antibody (H00004713-B01P)

Discover more about diseases related to NDUFB7 Antibody (H00004713-B01P).
 

Pathways for NDUFB7 Antibody (H00004713-B01P)

View related products by pathway.

PTMs for NDUFB7 Antibody (H00004713-B01P)

Learn more about PTMs related to NDUFB7 Antibody (H00004713-B01P).
 

Research Areas for NDUFB7 Antibody (H00004713-B01P)

Find related products by research area.

Blogs on NDUFB7

There are no specific blogs for NDUFB7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFB7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFB7
Uniprot