NDUFB5 Antibody - BSA Free

Western Blot: NDUFB5 Antibody [NBP1-59500] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NDUFB5 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to NDUFB5(NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa) The peptide sequence was selected from the middle region of NDUFB5. Peptide sequence KLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPIS The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: 5, mitochondrial.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFB5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 26790384)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NDUFB5 Antibody - BSA Free

• 5 (16kD, SGDH)
• CISGDH
• CI-SGDH
• Complex I-SGDH
• DKFZp686N02262
• FLJ30597
• MGC111204
• MGC12314
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa
• NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
• SGDH

Background

NDUFB5 is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NDUFB5 Antibody (NBP1-59500)(2)

Publications using NBP1-59500

• Kang K, Ko J, Lee H et al. Surgically Metabolic Resection of Pericardial Fat to Ameliorate Myocardial Mitochondrial Dysfunction in the Acute Myocardial Infarction Obese Rat Journal of Korean Medical Science 2022-02-08 [PMID: 35257523] (WB, Rat)
• Kang KW, Kim OS, Chin JY et al. Diastolic Dysfunction Induced by a High-Fat Diet Is Associated with Mitochondrial Abnormality and Adenosine Triphosphate Levels in Rats. Endocrinol Metab (Seoul). 2015-12-01 [PMID: 26790384] (WB, Rat)

Bioinformatics

• Gene Symbol: NDUFB5
• Uniprot:
  • O43674(Human)