NDUFB1 Antibody

Images

 
Western Blot: NDUFB1 Antibody [H00004707-D01P] - Analysis of NDUFB1 expression in transfected 293T cell line by NDUFB1 polyclonal antibody.Lane 1: NDUFB1 transfected lysate(11.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFB1 Antibody Summary

Immunogen
NDUFB1 (NP_004536.2, 1 a.a. - 105 a.a.) full-length human protein. MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALGLGVAVGAEAAAIMVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
Specificity
Reacts with NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFB1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFB1 Antibody

  • CI-MNLLCI-SGDH
  • complex I MNLL subunit
  • Complex I-MNLL
  • MNLL
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1 (7kD, MNLL)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
  • NADH-ubiquinone oxidoreductase MNLL subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP2-33425
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-05767
Species: Ha, Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00010875-M01
Species: Hu, Mu, Rt
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, WB
NBP2-16311
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-26245
Species: Hu, Mu
Applications: Flow, In vitro
MAB197
Species: Hu
Applications: CyTOF-reported, Flow, ICC, IHC, Neut
NBP1-81440
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-75563
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-88498
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
1726-JG
Species: Hu
Applications: BA

Publications for NDUFB1 Antibody (H00004707-D01P) (0)

There are no publications for NDUFB1 Antibody (H00004707-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB1 Antibody (H00004707-D01P) (0)

There are no reviews for NDUFB1 Antibody (H00004707-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFB1 Antibody (H00004707-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFB1 Products

Bioinformatics Tool for NDUFB1 Antibody (H00004707-D01P)

Discover related pathways, diseases and genes to NDUFB1 Antibody (H00004707-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for NDUFB1 Antibody (H00004707-D01P)

Find related products by research area.

Blogs on NDUFB1

There are no specific blogs for NDUFB1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFB1
Entrez
Uniprot