NDUFA1 Antibody (3B9-1A1) - Azide and BSA Free

Western Blot: NDUFA1 Antibody (3B9-1A1) [H00004694-M01] - Detection against Immunogen (30.91 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3B9-1A1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NDUFA1 Antibody (3B9-1A1) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: NDUFA1 (AAH00266, 24 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
• Specificity: NDUFA1 - NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NDUFA1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFA1 Antibody (3B9-1A1) - Azide and BSA Free

• CI-MWFEcomplex I MWFE subunit
• Complex I-MWFE
• MWFENADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE)
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
• NADH oxidoreductase subunit MWFE
• NADH:ubiquinone oxidoreductase (complex 1)
• NADH-ubiquinone oxidoreductase MWFE subunit
• type I dehydrogenase
• ZNF183

Background

The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFA1
• Entrez:
  • 4694(Human)
• OMIM:
  • 300078(Human)
• Uniprot:
  • AAH00266(Human)