NCKAP5 Antibody

Images

 
Immunohistochemistry: NCKAP5 Antibody [NBP1-90474] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NCKAP5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SKLTHSVSDSLFGWETNRKHFLEGTSSVYPKERPEKLTSCASSCPLEMKLCPSVQTPQVQRERGPQGQGHGRMALNLQLSD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCKAP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NCKAP5 Protein (NBP1-90474PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NCKAP5 Antibody

  • ERIH
  • ERIH1
  • ERIH2
  • FLJ34870
  • NAP5
  • NAP-5
  • Nck associated protein 5
  • NCK-associated protein 5
  • peripheral clock protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6017
Species: Rt
Applications: WB
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
MAB5809
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86489
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83204
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88924
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
NBP1-83408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2000
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NCKAP5 Antibody (NBP1-90474) (0)

There are no publications for NCKAP5 Antibody (NBP1-90474).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCKAP5 Antibody (NBP1-90474) (0)

There are no reviews for NCKAP5 Antibody (NBP1-90474). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NCKAP5 Antibody (NBP1-90474) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NCKAP5 Products

Bioinformatics Tool for NCKAP5 Antibody (NBP1-90474)

Discover related pathways, diseases and genes to NCKAP5 Antibody (NBP1-90474). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCKAP5 Antibody (NBP1-90474)

Discover more about diseases related to NCKAP5 Antibody (NBP1-90474).

Blogs on NCKAP5

There are no specific blogs for NCKAP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCKAP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCKAP5