NCF4 Recombinant Protein Antigen

Images

 
There are currently no images for NCF4 Recombinant Protein Antigen (NBP2-58290PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NCF4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCF4.

Source: E. coli

Amino Acid Sequence: EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NCF4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58290.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NCF4 Recombinant Protein Antigen

  • MGC3810
  • NCF
  • NCF-4
  • neutrophil cytosol factor 4
  • neutrophil cytosolic factor 4 (40kD)
  • neutrophil cytosolic factor 4, 40kDa
  • Neutrophil NADPH oxidase factor 4
  • p40phox
  • p40-phox
  • SH3 and PX domain-containing protein 4
  • SH3PXD4P40PHOX

Background

The NADPH oxidase generates superoxide in phagocytic cells. It is important for immunity and its deficiency leads to chronic granulomatous disease (CGD) (1). p40-phox is a newly isolated cytosolic component of the nicotinamide adenine dinucleotide phosphate (NADPH)-oxidase that copurifies with p67-phox. Preliminary evidence indicates that it is a component of the cytosolic complex (2). Maximal activation of NADPH oxidase requires formation of a complex between the p40-phox and p67-phox subunits via association of their PB1 domains. The crystal structure of the p40-phox/p67phox PB1 heterodimer reveals that both domains have a beta grasp topology and that they bind in a front-to-back arrangement through conserved electrostatic interactions between an acidic OPCA motif on p40-phox and basic residues in p67-phox (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-790
Species: Ba, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, PEP-ELISA, WB
NBP1-82542
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-41291
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-03403
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NBP1-84022
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
409-ML
Species: Mu
Applications: BA
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
NBP1-81796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32956
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB1904
Species: Hu
Applications: ICC, IHC, WB
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-58290PEP
Species: Hu
Applications: AC

Publications for NCF4 Recombinant Protein Antigen (NBP2-58290PEP) (0)

There are no publications for NCF4 Recombinant Protein Antigen (NBP2-58290PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCF4 Recombinant Protein Antigen (NBP2-58290PEP) (0)

There are no reviews for NCF4 Recombinant Protein Antigen (NBP2-58290PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NCF4 Recombinant Protein Antigen (NBP2-58290PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCF4 Products

Research Areas for NCF4 Recombinant Protein Antigen (NBP2-58290PEP)

Find related products by research area.

Blogs on NCF4

There are no specific blogs for NCF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NCF4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NCF4