NCF4 Antibody

Western Blot: NCF4 Antibody [H00004689-D01P] - Analysis of NCF4 expression in transfected 293T cell line by NCF4 polyclonal antibody.Lane 1: NCF4 transfected lysate(39.00 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: NCF4 Antibody [H00004689-D01P] - Analysis of antibody to NCF4 on HeLa cell. Antibody concentration 20 ug/ml.

Product Discontinued

NCF4 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: NCF4 (NP_000622.2, 1 a.a. - 339 a.a.) full-length human protein. MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
• Specificity: Reacts with neutrophil cytosolic factor 4, 40kDa.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCF4
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NCF4 Antibody

• MGC3810
• NCF
• NCF-4
• neutrophil cytosol factor 4
• neutrophil cytosolic factor 4 (40kD)
• neutrophil cytosolic factor 4, 40kDa
• Neutrophil NADPH oxidase factor 4
• p40phox
• p40-phox
• SH3 and PX domain-containing protein 4
• SH3PXD4P40PHOX

Background

The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NCF4
• Entrez:
  • 4689(Human)
• Uniprot:
  • NP_000622.2(Human)