NCF4 Antibody (3C10)

Images

 
Sandwich ELISA: NCF4 Antibody (3C10) [H00004689-M01] - Detection limit for recombinant GST tagged NCF4 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NCF4 Antibody (3C10) Summary

Immunogen
NCF4 (AAH02798, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE
Localization
Cytoplasmic
Specificity
NCF4 - neutrophil cytosolic factor 4, 40kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NCF4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NCF4 Antibody (3C10)

  • MGC3810
  • NCF
  • NCF-4
  • neutrophil cytosol factor 4
  • neutrophil cytosolic factor 4 (40kD)
  • neutrophil cytosolic factor 4, 40kDa
  • Neutrophil NADPH oxidase factor 4
  • p40phox
  • p40-phox
  • SH3 and PX domain-containing protein 4
  • SH3PXD4P40PHOX

Background

The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP1-82542
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-40974
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
409-ML/CF
Species: Mu
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
MAB1904
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for NCF4 Antibody (H00004689-M01) (0)

There are no publications for NCF4 Antibody (H00004689-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCF4 Antibody (H00004689-M01) (0)

There are no reviews for NCF4 Antibody (H00004689-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NCF4 Antibody (H00004689-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NCF4 Products

Bioinformatics Tool for NCF4 Antibody (H00004689-M01)

Discover related pathways, diseases and genes to NCF4 Antibody (H00004689-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCF4 Antibody (H00004689-M01)

Discover more about diseases related to NCF4 Antibody (H00004689-M01).
 

Pathways for NCF4 Antibody (H00004689-M01)

View related products by pathway.

PTMs for NCF4 Antibody (H00004689-M01)

Learn more about PTMs related to NCF4 Antibody (H00004689-M01).
 

Research Areas for NCF4 Antibody (H00004689-M01)

Find related products by research area.

Blogs on NCF4

There are no specific blogs for NCF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCF4 Antibody (3C10) and receive a gift card or discount.

Bioinformatics

Gene Symbol NCF4
Entrez
OMIM
Uniprot