NCAPH Antibody (1C9)

Images

 
Western Blot: NCAPH Antibody (1C9) [H00023397-M01] - BRRN1 monoclonal antibody (M01), clone 1C9 Analysis of BRRN1 expression in Jurkat.
Western Blot: NCAPH Antibody (1C9) [H00023397-M01] - Analysis of NCAPH expression in transfected 293T cell line by NCAPH monoclonal antibody (M01), clone 1C9.Lane 1: NCAPH transfected lysate (Predicted MW: 82.5 ...read more
Sandwich ELISA: NCAPH Antibody (1C9) [H00023397-M01] - Detection limit for recombinant GST tagged BRRN1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1C9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NCAPH Antibody (1C9) Summary

Immunogen
BRRN1 (AAH24211, 645 a.a. ~ 741 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKLKQSMWSLLTALSGKEADAEANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQGD
Specificity
BRRN1 - barren homolog (Drosophila)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NCAPH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NCAPH Antibody (1C9)

  • barren (Drosophila) homolog
  • barren homolog (Drosophila)
  • barren homolog 1 (Drosophila)
  • barren homolog 1
  • Barren homolog protein 1
  • BRRN
  • BRRN1CAP-H
  • CAPH
  • Chromosome-associated protein H
  • condensin complex subunit 2
  • HCAP-H
  • KIAA0074
  • Non-SMC condensin I complex subunit H
  • non-SMC condensin I complex, subunit H
  • XCAP-H homolog

Background

This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-373
Species: Hu
Applications: ICC/IF, IP, KD, WB
H00009918-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-86635
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-207
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-83281
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-49620
Species: Hu
Applications: IA, ICC/IF, IHC, IHC-P, WB
NB100-1573
Species: Hu
Applications: ICC/IF, IP, WB
H00011190-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-76393
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC, IHC-P, IP, WB
H00064151-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91348
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-83077
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-12904
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, WB
NB100-87021
Species: Hu
Applications: IP, WB
H00023397-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for NCAPH Antibody (H00023397-M01) (0)

There are no publications for NCAPH Antibody (H00023397-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCAPH Antibody (H00023397-M01) (0)

There are no reviews for NCAPH Antibody (H00023397-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NCAPH Antibody (H00023397-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NCAPH Products

Bioinformatics Tool for NCAPH Antibody (H00023397-M01)

Discover related pathways, diseases and genes to NCAPH Antibody (H00023397-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCAPH Antibody (H00023397-M01)

Discover more about diseases related to NCAPH Antibody (H00023397-M01).
 

Pathways for NCAPH Antibody (H00023397-M01)

View related products by pathway.

PTMs for NCAPH Antibody (H00023397-M01)

Learn more about PTMs related to NCAPH Antibody (H00023397-M01).
 

Research Areas for NCAPH Antibody (H00023397-M01)

Find related products by research area.

Blogs on NCAPH

There are no specific blogs for NCAPH, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCAPH Antibody (1C9) and receive a gift card or discount.

Bioinformatics

Gene Symbol NCAPH
Entrez
OMIM
Uniprot