Recombinant Human NCAPG2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NCAPG2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 177-274 of Human LUZP5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TKTGADVCRLWRIHQALYCFDYDLEESGEIKDMLLECFININYIKKEEGRRFLSCLFNWNINFIKMIHGTIKNQLQGLQKSLMVYIAEIYFRAWKKAS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NCAPG2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NCAPG2 Protein

  • Chromosome-associated protein G2
  • FLJ20311
  • Leucine zipper protein 5CAP-G2hCAP-G2condensin-2 complex subunit G2
  • LUZP5
  • more than blood homolog
  • MTB
  • Non-SMC condensin II complex subunit G2
  • non-SMC condensin II complex, subunit G2

Background

LUZP5 - leucine zipper protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-52553
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP2-56413
Species: Hu
Applications: WB, ICC/IF
AF1235
Species: Hu
Applications: WB, IHC
NBP2-56060
Species: Hu
Applications: ICC/IF
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00030813-R02
Species: Hu
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00054892-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for NCAPG2 Partial Recombinant Protein (H00054892-Q01) (0)

There are no publications for NCAPG2 Partial Recombinant Protein (H00054892-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCAPG2 Partial Recombinant Protein (H00054892-Q01) (0)

There are no reviews for NCAPG2 Partial Recombinant Protein (H00054892-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NCAPG2 Partial Recombinant Protein (H00054892-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCAPG2 Products

Bioinformatics Tool for NCAPG2 Partial Recombinant Protein (H00054892-Q01)

Discover related pathways, diseases and genes to NCAPG2 Partial Recombinant Protein (H00054892-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCAPG2 Partial Recombinant Protein (H00054892-Q01)

Discover more about diseases related to NCAPG2 Partial Recombinant Protein (H00054892-Q01).
 

Pathways for NCAPG2 Partial Recombinant Protein (H00054892-Q01)

View related products by pathway.

PTMs for NCAPG2 Partial Recombinant Protein (H00054892-Q01)

Learn more about PTMs related to NCAPG2 Partial Recombinant Protein (H00054892-Q01).

Blogs on NCAPG2

There are no specific blogs for NCAPG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NCAPG2 Antibody
NB100-1813
IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NCAPG2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NCAPG2