We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

NCAPD3 Recombinant Protein Antigen

Images

 
There are currently no images for NCAPD3 Recombinant Protein Antigen (NBP2-55493PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NCAPD3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCAPD3.

Source: E. coli

Amino Acid Sequence: AFHIWSKKEKFSPTFINNVISHTGTEHSAPAWMLLSKIAGSSPRLDYSRIIQSWEKISSQQNPNSNTLGHILCVIGHIAKHLPKSTRDKVTDAVKCK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NCAPD3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55493.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NCAPD3 Recombinant Protein Antigen

  • CAPD3
  • CAP-D3
  • FLJ42888
  • hCAP-D3condensin-2 complex subunit D3
  • hcp-6
  • hHCP-6
  • KIAA0056MGC104671
  • Non-SMC condensin II complex subunit D3
  • non-SMC condensin II complex, subunit D3

Background

Smad3 is a 50 kDa member of a family of proteins that act as key mediators of TGF beta superfamily signaling in cell proliferation, differentiation and development. The Smad family is divided into three subclasses: receptor regulated Smads, activin/TGF beta receptor regulated (Smad2 and 3) or BMP receptor regulated (Smad 1, 5, and 8); the common partner, (Smad4) that functions via its interaction to the various Smads; and the inhibitory Smads, (Smad6 and 7). Activated Smad3 oligomerizes with Smad4 upon TGF beta stimulation and translocates as a complex into the nucleus, allowing its binding to DNA and transcription factors. Phosphorylation of the two TGF beta dependent serines 423 and 425 in the C terminus of Smad3 is critical for Smad3 transcriptional activity and TGF beta signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009918-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB100-373
Species: Hu
Applications: ICC/IF, IP, KD, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NBP3-38210
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-558
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB
NBP1-89296
Species: Hu
Applications: IHC,  IHC-P, WB
DGD150
Species: Hu
Applications: ELISA
NBP1-87294
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-38206
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP2-73301
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, WB
NB100-68209
Species: Hu
Applications: IP, KD, WB
NBP1-88345
Species: Hu
Applications: ICC/IF,  IHC-P, KD, Simple Western, WB
NBP1-87232
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DRN00B
Species: Hu
Applications: ELISA
NBP2-33735
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82455
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF,  IHC-P, WB
DCP00
Species: Hu
Applications: ELISA
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-55493PEP
Species: Hu
Applications: AC

Publications for NCAPD3 Recombinant Protein Antigen (NBP2-55493PEP) (0)

There are no publications for NCAPD3 Recombinant Protein Antigen (NBP2-55493PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCAPD3 Recombinant Protein Antigen (NBP2-55493PEP) (0)

There are no reviews for NCAPD3 Recombinant Protein Antigen (NBP2-55493PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NCAPD3 Recombinant Protein Antigen (NBP2-55493PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCAPD3 Products

Research Areas for NCAPD3 Recombinant Protein Antigen (NBP2-55493PEP)

Find related products by research area.

Blogs on NCAPD3

There are no specific blogs for NCAPD3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NCAPD3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NCAPD3