Recombinant Human NBR1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NBR1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 966 of Human NBR1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCTSVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSEESPDNIEKGMISSSKTDDLTCQQEETFLLAKEERQLGEVTEQTEGTAACIPQKAKNVASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDVTPCMSPLPHDSPLIEKPGLGQIEEENEGAGFKALPDSMVSVKRKAENIASVEEAEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQKSLQMTFALPEGPLGNEKEEIIHIAEEEAVMEEEEDEEDEEEEDELKDEVQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGKPGVEAGQEPAEAGERLPGGENQPQEHSISDILTTSQTLETVPLIPEVVELPPSLPRSSPCVHHHGSPGVDLPVTIPEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKALFAGPPVTAQPIISEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNNDWYSQRY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NBR1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using
H00004077-P02 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NBR1 Protein

  • Cell migration-inducing gene 19 protein
  • FLJ98272
  • KIAA0049CA125
  • M17S2FLJ55359,1A1-3B
  • Membrane component chromosome 17 surface marker 2,1A13B
  • membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigenCA125)
  • migration-inducing protein 19
  • Neighbor of BRCA1 gene 1 protein
  • neighbor of BRCA1 gene 1
  • next to BRCA1 gene 1 protein
  • Protein 1A1-3B

Background

The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
H00010230-P01
Species: Hu
NBP1-84432
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31207
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-79833
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33691
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46224
Species: Hu
Applications: WB, IHC
H00004077-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for NBR1 Recombinant Protein (H00004077-P02)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NBR1 Recombinant Protein (H00004077-P02) (0)

There are no reviews for NBR1 Recombinant Protein (H00004077-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NBR1 Recombinant Protein (H00004077-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NBR1 Products

Bioinformatics Tool for NBR1 Recombinant Protein (H00004077-P02)

Discover related pathways, diseases and genes to NBR1 Recombinant Protein (H00004077-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NBR1 Recombinant Protein (H00004077-P02)

Discover more about diseases related to NBR1 Recombinant Protein (H00004077-P02).
 

Pathways for NBR1 Recombinant Protein (H00004077-P02)

View related products by pathway.

PTMs for NBR1 Recombinant Protein (H00004077-P02)

Learn more about PTMs related to NBR1 Recombinant Protein (H00004077-P02).

Blogs on NBR1.

Why LC3B Antibodies Make Ideal Autophagosomes Membrane Markers
The human form of microtubule-associated protein light chain 3 (LC3) is expressed as 3 splice variants; LC3A, LC3B and LC3C (He et al., 2003). LC3B is a subunit of the MAP1A and MAP1B microtubule-binding pr...  Read full blog post.

Customers Who Bought This Also Bought

LC3A Antibody
NB100-2331
NBR1 Antibody
NBP1-71703

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NBR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NBR1