NAT9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NAT9 Antibody [NBP2-58039] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAT9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEP
Specificity
Specificity of human NAT9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAT9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NAT9 Recombinant Protein Antigen (NBP2-58039PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NAT9 Antibody

  • DKFZP564C103
  • EBS
  • EBSP, hNATL
  • EC 2.3.1.-
  • embryo brain specific protein
  • Embryo brain-specific protein
  • N-acetyltransferase 9 (GCN5-related, putative)
  • N-acetyltransferase 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66826
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NB110-56916
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-536
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16366
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-70694
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-31113
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24837
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84019
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NAT9 Antibody (NBP2-58039) (0)

There are no publications for NAT9 Antibody (NBP2-58039).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAT9 Antibody (NBP2-58039) (0)

There are no reviews for NAT9 Antibody (NBP2-58039). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NAT9 Antibody (NBP2-58039) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NAT9 Products

Bioinformatics Tool for NAT9 Antibody (NBP2-58039)

Discover related pathways, diseases and genes to NAT9 Antibody (NBP2-58039). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAT9 Antibody (NBP2-58039)

Discover more about diseases related to NAT9 Antibody (NBP2-58039).
 

Pathways for NAT9 Antibody (NBP2-58039)

View related products by pathway.

Blogs on NAT9

There are no specific blogs for NAT9, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAT9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAT9