NASP Antibody

Immunocytochemistry/Immunofluorescence: NASP Antibody [38700002] - This image is specific to animal number SDQ2365 1:1000; methanol fixation; 1 hr

Immunocytochemistry/Immunofluorescence: NASP Antibody [38700002] - This image is specific to animal number SDQ2364 Staining in P-granules and nucleus

Product Discontinued

NASP Antibody Summary

• Immunogen: In vivo generated recombinant protein fragment
• Epitope: KKSEFENELKELEEMMPGVEEMIADAVHSAAQVEETKKAIKAQFEGFTQVLAKLPQEAGDQKEANDISSLVRRPAKRAVDAPTDNQAVKKEKEEEGTTSI
• Specificity: Caenorhabditis elegans NASP-1
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NASP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
• Application Notes: This product is useful for ELISA and for Immunofluorescence.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Concentration: 1 mg/ml
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for NASP Antibody

• DKFZp547F162
• FLB7527
• FLJ31599
• FLJ35510
• histone H1-binding protein
• MGC19722
• MGC20372
• MGC2297
• nuclear autoantigenic sperm protein (histone-binding)
• nuclear autoantigenic sperm protein
• PRO1999

Background

NASP is required for DNA replication, normal cell cycle progression, and cell proliferation. It forms a cytoplasmic complex with HSP90 and H1 linker histones and stimulates HSP90 ATPase activity. NASP and H1 histone are subsequently released from the complex and translocate to the nucleus where the histone is released for binding to DNA. [from: http://www.genecards.org/cgi-bin/carddisp.pl®gene=NASP&search=NASP]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NASP
• Entrez:
  • 174697(C. elegans)
• Uniprot:
  • Q17886(C. elegans)