NARG1L Antibody

Images

 
Western Blot: NARG1L Antibody [NBP1-53124] - HepG2 tissue lysate at a concentration of 0.5ug/ml.
Immunohistochemistry-Paraffin: NARG1L Antibody [NBP1-53124] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NARG1L Antibody Summary

Immunogen
Synthetic peptides corresponding to NARG1L(NMDA receptor regulated 1-like) The peptide sequence was selected from the middle region of NARG1L. Peptide sequence ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAA16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against NARG1L and was validated on Western Blot and immunohistochemistry-P

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NARG1L Antibody

  • FLJ22054
  • MGC40612
  • N(alpha)-acetyltransferase 16, NatA auxiliary subunit
  • N-alpha-acetyltransferase 16, NatA auxiliary subunit
  • NARG1L
  • NARG1-like protein
  • NAT2
  • NMDA receptor regulated 1-like
  • NMDA receptor-regulated 1-like protein
  • PRO2435

Background

NARG1L may belong to a complex displaying N-terminal acetyltransferase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
24790002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-81010
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60103
Species: Hu
Applications: WB, IHC
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P

Publications for NARG1L Antibody (NBP1-53124) (0)

There are no publications for NARG1L Antibody (NBP1-53124).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NARG1L Antibody (NBP1-53124) (0)

There are no reviews for NARG1L Antibody (NBP1-53124). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NARG1L Antibody (NBP1-53124) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NARG1L Products

Bioinformatics Tool for NARG1L Antibody (NBP1-53124)

Discover related pathways, diseases and genes to NARG1L Antibody (NBP1-53124). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NARG1L

There are no specific blogs for NARG1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NARG1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAA16
Uniprot