Nardilysin Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NRDC |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Nardilysin Antibody - BSA Free
Background
NRD1, also known as Nardilysin, has 2 isoforms, a 1,150 amino acid isoform1 that is 132 kDa and a 1,218 amino acid isoform2 that is 139 kDa, primarily found in adult heart, skeletal muscle, and testis, it is a member of the peptidase M16 family, and slices peptide substrates at the N-terminus of arginine residues in dibasic moieties. Disease research is being performed in relation to NRD1 and differentiating neuroblastoma, Down syndrome, Alzheimer's disease, neuroblastoma, prostatitis, neuronitis, and alcoholism. Interactions with NRD1 protein have been shown to involve TP53, HBEGF, CALCA, MYC, FBXW11, and more than 50 other proteins in proteolysis, neuromuscular junction development, cell proliferation, cell migration, and positive regulation of membrane protein ectodomain proteolysis processes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, PA, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, In vivo, RIA, WB
Publications for Nardilysin Antibody (NBP2-58484) (0)
There are no publications for Nardilysin Antibody (NBP2-58484).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Nardilysin Antibody (NBP2-58484) (0)
There are no reviews for Nardilysin Antibody (NBP2-58484).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Nardilysin Antibody (NBP2-58484) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Nardilysin Products
Research Areas for Nardilysin Antibody (NBP2-58484)
Find related products by research area.
|
Blogs on Nardilysin