NAD Synthetase Antibody (4G9)

Images

 
Western Blot: NAD Synthetase Antibody (4G9) [H00055191-M01] - NADSYN1 monoclonal antibody (M01), clone 4G9 Analysis of NADSYN1 expression in Hela S3 NE.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4G9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NAD Synthetase Antibody (4G9) Summary

Immunogen
NADSYN1 (NP_004981, 609 a.a. ~ 706 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KMGPYSMFCKLLGMWRHICTPRQVADKVKRFFSKYSMNRHKMTTLTPAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDGVD
Specificity
NADSYN1 - NAD synthetase 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NADSYN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NAD Synthetase Antibody (4G9)

  • EC 6.3.5.1
  • FLJ10631
  • FLJ36703
  • FLJ40627
  • glutamine-dependent NAD synthetase
  • glutamine-dependent NAD(+) synthetase
  • NAD synthetase 1
  • NAD(+) synthase [glutamine-hydrolyzing]
  • NAD(+) synthase
  • NAD(+) synthetase

Background

Nicotinamide adenine dinucleotide (NAD) is a coenzyme in metabolic redox reactions, a precursor for several cell signaling molecules, and a substrate for protein posttranslational modifications. NAD synthetase (EC 6.3.5.1) catalyzes the final step in the biosynthesis of NAD from nicotinic acid adenine dinucleotide (NaAD).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50204
Species: Hu, Mu
Applications: WB, ELISA, IHC
H00001717-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-92637
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-66778
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-83978
Species: Hu
Applications: IHC, IHC-P
MAB6858
Species: Hu
Applications: WB, IHC
NBP1-85495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-89766
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-88820
Species: Mu
Applications: WB
NBP1-85871
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85296
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready

Publications for NAD Synthetase Antibody (H00055191-M01) (0)

There are no publications for NAD Synthetase Antibody (H00055191-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAD Synthetase Antibody (H00055191-M01) (0)

There are no reviews for NAD Synthetase Antibody (H00055191-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NAD Synthetase Antibody (H00055191-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NAD Synthetase Products

Bioinformatics Tool for NAD Synthetase Antibody (H00055191-M01)

Discover related pathways, diseases and genes to NAD Synthetase Antibody (H00055191-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAD Synthetase Antibody (H00055191-M01)

Discover more about diseases related to NAD Synthetase Antibody (H00055191-M01).

PTMs for NAD Synthetase Antibody (H00055191-M01)

Learn more about PTMs related to NAD Synthetase Antibody (H00055191-M01).

Blogs on NAD Synthetase

There are no specific blogs for NAD Synthetase, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAD Synthetase Antibody (4G9) and receive a gift card or discount.

Bioinformatics

Gene Symbol NADSYN1
Entrez
OMIM
Uniprot