NAA10 Antibody

Images

 
Western Blot: NAA10 Antibody [H00008260-B01P] - Analysis of ARD1A expression in human pancreas.
Western Blot: NAA10 Antibody [H00008260-B01P] - Analysis of ARD1A expression in Jurkat.
Western Blot: NAA10 Antibody [H00008260-B01P] - Analysis of ARD1A expression in transfected 293T cell line by ARD1A polyclonal antibody. Lane 1: ARD1A transfected lysate(25.85 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Product Discontinued
View other related NAA10 Primary Antibodies

Order Details


    • Catalog Number
      H00008260-B01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NAA10 Antibody Summary

Immunogen
ARD1A (NP_003482.1, 1 a.a. - 235 a.a.) full-length human protein. MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
Specificity
Reacts with ARD1 homolog A, N-acetyltransferase (S. cerevisiae).
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NAA10
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NAA10 Antibody

  • ARD1 homolog A, N-acetyltransferase (S. cerevisiae)
  • ARD1 homolog, N-acetyltransferase (S. cerevisiae)
  • ARD1
  • ARD1AARD1 homolog, N-acetyltransferase
  • EC 2.3.1.-
  • EC 2.3.1.88
  • MGC71248
  • N(alpha)-acetyltransferase 10, NatA catalytic subunit
  • N-acetyltransferase ARD1, human homolog of
  • N-acetyltransferase
  • N-alpha-acetyltransferase 10, NatA catalytic subunit
  • N-terminal acetyltransferase complex ARD1 subunit homolog A

Background

N-alpha-acetylation is one of the most common protein modifications that occurs during protein synthesis and involves the transfer of an acetyl group from acetyl-coenzyme A to the protein alpha-amino group. ARD1A, together with NATH (NARG1; MIM 608000), is part of a major N-alpha-acetyltransferase complex responsible for alpha-acetylation of proteins and peptides (Sanchez-Puig and Fersht, 2006 [PubMed 16823041]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ma, Pm, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KD, KO, LA
NBP1-21387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
24790002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-60103
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP1-81010
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB120-11929
Species: Hu, Mu
Applications: WB, Flow
NBP2-67618
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56519
Species: Hu, Mu, Rt, Po, Bv, Sh
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, IHC-FrFl, KD
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-78620
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24695
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-93356
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84591
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14998
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)

Publications for NAA10 Antibody (H00008260-B01P) (0)

There are no publications for NAA10 Antibody (H00008260-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAA10 Antibody (H00008260-B01P) (0)

There are no reviews for NAA10 Antibody (H00008260-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NAA10 Antibody (H00008260-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NAA10 Products

Bioinformatics Tool for NAA10 Antibody (H00008260-B01P)

Discover related pathways, diseases and genes to NAA10 Antibody (H00008260-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAA10 Antibody (H00008260-B01P)

Discover more about diseases related to NAA10 Antibody (H00008260-B01P).
 

Pathways for NAA10 Antibody (H00008260-B01P)

View related products by pathway.

PTMs for NAA10 Antibody (H00008260-B01P)

Learn more about PTMs related to NAA10 Antibody (H00008260-B01P).

Blogs on NAA10

There are no specific blogs for NAA10, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAA10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAA10
Entrez
Uniprot