N-WASP Antibody (5F4)

Images

 
Western Blot: N-WASP Antibody (5F4) [H00008976-M04] - Analysis of WASL expression in IMR-32 (Cat # L008V1).
Immunocytochemistry/ Immunofluorescence: N-WASP Antibody (5F4) [H00008976-M04] - Analysis of monoclonal antibody to WASL on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: N-WASP Antibody (5F4) [H00008976-M04] - Analysis of monoclonal antibody to WASL on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 0.8 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
5F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

N-WASP Antibody (5F4) Summary

Immunogen
WASL (NP_003932, 97 a.a. - 184 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISH
Specificity
WASL - Wiskott-Aldrich syndrome-like
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
WASL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publication using
H00008976-M04 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for N-WASP Antibody (5F4)

  • NWASP
  • N-WASP
  • N-WASPneural WiskNWASP
  • TRS4
  • WASL
  • WiskDKFZp779G0847
  • WiskMGC48327

Background

The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that they are regulated by a number of different stimuli, and interact with multiple proteins. Recent studies have demonstrated that these proteins, directly or indirectly, associate with the small GTPase, Cdc42, known to regulate formation of actin filaments, and the cytoskeletal organizing complex, Arp2/3. The WASL gene product is a homolog of WAS protein, however, unlike the latter, it is ubiquitously expressed and shows highest expression in neural tissues. It has been shown to bind Cdc42 directly, and induce formation of long actin microspikes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86859
Species: Hu
Applications: WB, IHC, IHC-P
AF5514
Species: Hu, Mu
Applications: WB
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7008
Species: Hu
Applications: WB, ICC
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-37912
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for N-WASP Antibody (H00008976-M04)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for N-WASP Antibody (H00008976-M04) (0)

There are no reviews for N-WASP Antibody (H00008976-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for N-WASP Antibody (H00008976-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional N-WASP Products

Bioinformatics Tool for N-WASP Antibody (H00008976-M04)

Discover related pathways, diseases and genes to N-WASP Antibody (H00008976-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for N-WASP Antibody (H00008976-M04)

Discover more about diseases related to N-WASP Antibody (H00008976-M04).
 

Pathways for N-WASP Antibody (H00008976-M04)

View related products by pathway.

PTMs for N-WASP Antibody (H00008976-M04)

Learn more about PTMs related to N-WASP Antibody (H00008976-M04).

Blogs on N-WASP

There are no specific blogs for N-WASP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N-WASP Antibody (5F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol WASL
Entrez
OMIM
Uniprot