N-WASP Antibody (5F4) - Azide and BSA Free

Western Blot: N-WASP Antibody (5F4) [H00008976-M04] - Analysis of WASL expression in IMR-32 (Cat # L008V1).

Immunocytochemistry/Immunofluorescence: N-WASP Antibody (5F4) [H00008976-M04] - Analysis of monoclonal antibody to WASL on HeLa cell. Antibody concentration 10 ug/ml

Immunohistochemistry-Paraffin: N-WASP Antibody (5F4) [H00008976-M04] - Analysis of monoclonal antibody to WASL on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 0.8 ug/ml

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 5F4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

N-WASP Antibody (5F4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: WASL (NP_003932, 97 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISH
• Specificity: WASL - Wiskott-Aldrich syndrome-like
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: WASL
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for N-WASP Antibody (5F4) - Azide and BSA Free

• NWASP
• N-WASP
• N-WASPneural WiskNWASP
• TRS4
• WASL
• WiskDKFZp779G0847
• WiskMGC48327

Background

The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that they are regulated by a number of different stimuli, and interact with multiple proteins. Recent studies have demonstrated that these proteins, directly or indirectly, associate with the small GTPase, Cdc42, known to regulate formation of actin filaments, and the cytoskeletal organizing complex, Arp2/3. The WASL gene product is a homolog of WAS protein, however, unlike the latter, it is ubiquitously expressed and shows highest expression in neural tissues. It has been shown to bind Cdc42 directly, and induce formation of long actin microspikes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for N-WASP Antibody (H00008976-M04)(1)

Publication using H00008976-M04

• Li HP, Huang HY, Lai YR et al. Silencing of miRNA-148a by hypermethylation activates the integrin-mediated signaling pathway in nasopharyngeal carcinoma. Oncotarget. 2014-09-15 [PMID: 25277193] (WB, Human)
  
  Details:
  ROCK1 antibody used for WB on lysates of miR-148a transient transfected TW02 cells (Figure 4b), shROCK1 knockdown TW02 and TW06 cells (Figure 5a), NPC tumor (Figure 5f),

Bioinformatics

• Gene Symbol: WASL
• Entrez:
  • 8976(Human)
• OMIM:
  • 605056(Human)
• Uniprot:
  • NP_003932(Human)