N-Acetylglucosaminyltransferase V/MGAT5 Antibody (3E9.)

Images

 
Western Blot: N-Acetylglucosaminyltransferase V/MGAT5 Antibody (3E9) [H00004249-M09] - Analysis of MGAT5 expression in Jurkat (Cat # L017V1).
Immunohistochemistry-Paraffin: N-Acetylglucosaminyltransferase V/MGAT5 Antibody (3E9) [H00004249-M09] - Analysis of monoclonal antibody to MGAT5 on formalin-fixed paraffin-embedded human small Intestine. Antibody ...read more
Sandwich ELISA: N-Acetylglucosaminyltransferase V/MGAT5 Antibody (3E9) [H00004249-M09] - Detection limit for recombinant GST tagged MGAT5 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
3E9.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

N-Acetylglucosaminyltransferase V/MGAT5 Antibody (3E9.) Summary

Immunogen
MGAT5 (NP_002401 642 a.a. - 739 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKD
Specificity
Reacts with mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MGAT5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate in WB and recombinant protein in ELISA.
Publications
Read Publication using
H00004249-M09 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (3E9.)

  • alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
  • Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase
  • EC 2.4.1.155
  • GGNT5
  • GlcNAc-T V
  • GNT-VGNT-VA
  • Mannoside acetylglucosaminyltransferase 5
  • mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase
  • MGAT5
  • N-Acetylglucosaminyltransferase V
  • N-acetylglucosaminyl-transferase V

Background

This gene encodes mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, a glycosyltransferase involved in the synthesis of protein-bound and lipid-bound oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the encoded protein's activity may correlate with the progression of invasive malignancies. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58992
Species: Hu
Applications: ICC/IF
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00004249-M09
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (H00004249-M09)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (H00004249-M09) (0)

There are no reviews for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (H00004249-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (H00004249-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional N-Acetylglucosaminyltransferase V/MGAT5 Products

Bioinformatics Tool for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (H00004249-M09)

Discover related pathways, diseases and genes to N-Acetylglucosaminyltransferase V/MGAT5 Antibody (H00004249-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (H00004249-M09)

Discover more about diseases related to N-Acetylglucosaminyltransferase V/MGAT5 Antibody (H00004249-M09).
 

Pathways for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (H00004249-M09)

View related products by pathway.

PTMs for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (H00004249-M09)

Learn more about PTMs related to N-Acetylglucosaminyltransferase V/MGAT5 Antibody (H00004249-M09).

Blogs on N-Acetylglucosaminyltransferase V/MGAT5

There are no specific blogs for N-Acetylglucosaminyltransferase V/MGAT5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N-Acetylglucosaminyltransferase V/MGAT5 Antibody (3E9.) and receive a gift card or discount.

Bioinformatics

Gene Symbol MGAT5
Entrez
Uniprot