N acetyl transferase 5 Antibody (2C6)

Images

 
Western Blot: N acetyl transferase 5 Antibody (2C6) [H00051126-M01] - NAT5 monoclonal antibody (M01), clone 2C6 Analysis of NAT5 expression in HL-60.
Sandwich ELISA: N acetyl transferase 5 Antibody (2C6) [H00051126-M01] - Detection limit for recombinant GST tagged NAT5 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
2C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

N acetyl transferase 5 Antibody (2C6) Summary

Immunogen
NAT5 (AAH05181, 1 a.a. ~ 178 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE
Specificity
NAT5 - N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NAA20
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publications using H00051126-M01.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for N acetyl transferase 5 Antibody (2C6)

  • dJ1002M8.1
  • dJ1175I6.2 (N-terminal acetyltransferase complex ard1 subunit)
  • EC 2.3.1.88
  • homolog)
  • N(alpha)-acetyltransferase 20, NatB catalytic subunit
  • N-acetyltransferase 3 homolog
  • N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae)
  • N-acetyltransferase 5 (GCN5-related, putative)
  • N-acetyltransferase 5
  • N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae
  • N-alpha-acetyltransferase 20, NatB catalytic subunit
  • NAT3N-terminal acetyltransferase B complex catalytic subunit NAT5
  • NAT5dJ1002M8.1 (N-terminal acetyltransferase complex ard1 subunit)
  • NatB complex subunit NAT5
  • N-terminal acetyltransferase B complex catalytic subunit NAA20
  • N-terminal acetyltransferase complex ARD1 subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for N acetyl transferase 5 Antibody (H00051126-M01)(3)

Reviews for N acetyl transferase 5 Antibody (H00051126-M01) (0)

There are no reviews for N acetyl transferase 5 Antibody (H00051126-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for N acetyl transferase 5 Antibody (H00051126-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N acetyl transferase 5 Antibody (2C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol NAA20
Entrez
Uniprot