Recombinant Human Myotilin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Myotilin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 399-498 of Human MYOT partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQSGLYESEEL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MYOT
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Myotilin Protein

  • 57 kDa cytoskeletal protein
  • LGMD1A
  • limb-girdle muscular dystrophy 1A (autosomal dominant)
  • Myofibrillar titin-like Ig domains protein
  • myotilin
  • titin immunoglobulin domain protein (myotilin)
  • Titin immunoglobulin domain protein
  • TTIDLGMD1

Background

Striated muscle sarcomeres are highly organized structures composed of actin (thin) and myosin (thick) filaments that slide past each other during contraction. The integrity of sarcomeres is controlled by a set of structural proteins, among which are titin (TTN; MIM 188840), a giant molecule that contains several immunoglobulin (Ig)-like domains and associates with thin and thick filaments, and alpha-actinin (ACTN1; MIM 102575), an actin crosslinking protein. Mutations in several sarcomeric and sarcolemmal proteins have been shown to result in muscular dystrophy and cardiomyopathy.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP1-85544
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85439
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-15109
Species: Hu
Applications: WB, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB110-5029
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89300
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00084665-M04
Species: Hu
Applications: WB, ELISA
NBP2-27398
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-80952
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
H00009499-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Myotilin Partial Recombinant Protein (H00009499-Q01) (0)

There are no publications for Myotilin Partial Recombinant Protein (H00009499-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myotilin Partial Recombinant Protein (H00009499-Q01) (0)

There are no reviews for Myotilin Partial Recombinant Protein (H00009499-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myotilin Partial Recombinant Protein (H00009499-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Myotilin Products

Bioinformatics Tool for Myotilin Partial Recombinant Protein (H00009499-Q01)

Discover related pathways, diseases and genes to Myotilin Partial Recombinant Protein (H00009499-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myotilin Partial Recombinant Protein (H00009499-Q01)

Discover more about diseases related to Myotilin Partial Recombinant Protein (H00009499-Q01).
 

Pathways for Myotilin Partial Recombinant Protein (H00009499-Q01)

View related products by pathway.

PTMs for Myotilin Partial Recombinant Protein (H00009499-Q01)

Learn more about PTMs related to Myotilin Partial Recombinant Protein (H00009499-Q01).

Blogs on Myotilin

There are no specific blogs for Myotilin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Desmin Antibody
NB120-15200-0.1ml
BAG3 Antibody
NBP2-27398

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Myotilin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MYOT