Myosin 1A Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Myosin 1A. Source: E. coli Amino Acid Sequence: FSLHLSEMSSVGSKGDFLLVSEHVIELLTKMYRAVLDATQRQLTVTVTEKFSVRFKENSVAVKVVQGPAGGDNSKLRY Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MYO1A |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55431. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Myosin 1A Recombinant Protein Antigen
Background
MYO1A, also known as Unconventional myosin-Ia, is a 1,043 amino acid protein that is 118 kDa, expressed by enterocytes, the epithelial cells that line the luminal surface of the small intestine, functions as actin-based molecular motor that, upon interaction with actin filaments, utilize energy from ATP hydrolysis to generate mechanical force, and potentially it is involved in directing the movement of organelles along actin filaments. Current research is being performed on this proteins involvement in deafness, autosomal dominant 48, spinal cord injury, brachial plexus injuries, sensorineural hearing loss, chronic obstructive pulmonary disease, myotonic dystrophy, pulmonary disease, t cell deficiency, and retinitis. The protein has been linked to the RhoA pathway, antioxidant action of vitamin-C, transendothelial migration of leukocytes, actin nucleation by ARP-WASP complex, epithelial adherens junctions, cellular effects of sildenafil, ILK signaling, epithelial tight junctions, RhoGDI pathway, PAK pathway, and Fc-GammaR-mediated phagocytosis in macrophages pathways where it interacts with BAZ1B, FBL, MAP3K3, SMARCA5, USP20, NEK6, PHLDA3, and over 50 other proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Ch, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
Species: Hu
Applications: ICC/IF, WB
Species: Dr, Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: AC
Publications for Myosin 1A Recombinant Protein Antigen (NBP2-55431PEP) (0)
There are no publications for Myosin 1A Recombinant Protein Antigen (NBP2-55431PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Myosin 1A Recombinant Protein Antigen (NBP2-55431PEP) (0)
There are no reviews for Myosin 1A Recombinant Protein Antigen (NBP2-55431PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Myosin 1A Recombinant Protein Antigen (NBP2-55431PEP) (0)
Additional Myosin 1A Products
Research Areas for Myosin 1A Recombinant Protein Antigen (NBP2-55431PEP)
Find related products by research area.
|
Blogs on Myosin 1A