Myosin 1A Recombinant Protein Antigen

Images

 
There are currently no images for Myosin 1A Recombinant Protein Antigen (NBP2-55431PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Myosin 1A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Myosin 1A.

Source: E. coli

Amino Acid Sequence: FSLHLSEMSSVGSKGDFLLVSEHVIELLTKMYRAVLDATQRQLTVTVTEKFSVRFKENSVAVKVVQGPAGGDNSKLRY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYO1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55431.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Myosin 1A Recombinant Protein Antigen

  • BBMI
  • BBM-I
  • Brush border myosin I
  • brush border myosin-I
  • DFNA48
  • MIHC
  • MYHL
  • Myosin I heavy chain
  • myosin IA
  • myosin, heavy polypeptide-like (100kD)
  • myosin-Ia

Background

MYO1A, also known as Unconventional myosin-Ia, is a 1,043 amino acid protein that is 118 kDa, expressed by enterocytes, the epithelial cells that line the luminal surface of the small intestine, functions as actin-based molecular motor that, upon interaction with actin filaments, utilize energy from ATP hydrolysis to generate mechanical force, and potentially it is involved in directing the movement of organelles along actin filaments. Current research is being performed on this proteins involvement in deafness, autosomal dominant 48, spinal cord injury, brachial plexus injuries, sensorineural hearing loss, chronic obstructive pulmonary disease, myotonic dystrophy, pulmonary disease, t cell deficiency, and retinitis. The protein has been linked to the RhoA pathway, antioxidant action of vitamin-C, transendothelial migration of leukocytes, actin nucleation by ARP-WASP complex, epithelial adherens junctions, cellular effects of sildenafil, ILK signaling, epithelial tight junctions, RhoGDI pathway, PAK pathway, and Fc-GammaR-mediated phagocytosis in macrophages pathways where it interacts with BAZ1B, FBL, MAP3K3, SMARCA5, USP20, NEK6, PHLDA3, and over 50 other proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP1-87739
Species: Ch, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP1-87745
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
AF8181
Species: Hu
Applications: IHC, KO, Simple Western, WB
NBP1-88899
Species: Hu
Applications: IHC,  IHC-P
AF8171
Species: Hu
Applications: IHC, Simple Western, WB
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
H00004646-M02
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP3-21878
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
NB100-56548
Species: Hu
Applications: ICC/IF, WB
NBP3-25355
Species: Dr, Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-92158
Species: Hu
Applications: IHC,  IHC-P, WB
H00005357-M04
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP2-33680
Species: Hu
Applications: IHC,  IHC-P
NBP2-55431PEP
Species: Hu
Applications: AC

Publications for Myosin 1A Recombinant Protein Antigen (NBP2-55431PEP) (0)

There are no publications for Myosin 1A Recombinant Protein Antigen (NBP2-55431PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin 1A Recombinant Protein Antigen (NBP2-55431PEP) (0)

There are no reviews for Myosin 1A Recombinant Protein Antigen (NBP2-55431PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Myosin 1A Recombinant Protein Antigen (NBP2-55431PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Myosin 1A Products

Research Areas for Myosin 1A Recombinant Protein Antigen (NBP2-55431PEP)

Find related products by research area.

Blogs on Myosin 1A

There are no specific blogs for Myosin 1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Myosin 1A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO1A