Myoglobin Antibody (4F8)

Images

 
Western Blot: Myoglobin Antibody (4F8) [H00004151-M13] - Analysis of MB expression in transfected 293T cell line by MB monoclonal antibody (M13), clone 4F8. Lane 1: MB transfected lysatE (17.2 KDa). Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: Myoglobin Antibody (4F8) [H00004151-M13] - Analysis of monoclonal antibody to MB on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: Myoglobin Antibody (4F8) [H00004151-M13] - Detection limit for recombinant GST tagged MB is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Myoglobin Antibody (4F8) Summary

Immunogen
MB (NP_005359.1, 2 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKI
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Myoglobin Antibody (4F8)

  • MB
  • MGC13548
  • Myoglobin
  • PVALB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB110-2546
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46395
Species: Hu
Applications: WB, IHC
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for Myoglobin Antibody (H00004151-M13) (0)

There are no publications for Myoglobin Antibody (H00004151-M13).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myoglobin Antibody (H00004151-M13) (0)

There are no reviews for Myoglobin Antibody (H00004151-M13). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Myoglobin Antibody (H00004151-M13) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myoglobin Products

Bioinformatics Tool for Myoglobin Antibody (H00004151-M13)

Discover related pathways, diseases and genes to Myoglobin Antibody (H00004151-M13). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myoglobin Antibody (H00004151-M13)

Discover more about diseases related to Myoglobin Antibody (H00004151-M13).
 

Pathways for Myoglobin Antibody (H00004151-M13)

View related products by pathway.

PTMs for Myoglobin Antibody (H00004151-M13)

Learn more about PTMs related to Myoglobin Antibody (H00004151-M13).

Blogs on Myoglobin

There are no specific blogs for Myoglobin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myoglobin Antibody (4F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol MB
Entrez
Uniprot