MYO1H Antibody

Images

 
Immunohistochemistry-Paraffin: MYO1H Antibody [NBP1-81945] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MYO1H Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VSTSNLSDGILVIHVSPEDSKQKGDAVLQCGHVFEAVTKLVMLVKKENIVNVVQGSLQFFISPGKEGTIVFDTGPEEQVYKNKNGQLTVVSG
Specificity
Specificity of human MYO1H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYO1H
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MYO1H Protein (NBP1-81945PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MYO1H Antibody

  • myosin IH
  • myosin-1H
  • myosin-Ih

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87745
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92158
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87739
Species: Hu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84558
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30661
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31598
Species: Hu
Applications: IHC, IHC-P
NBP2-55431
Species: Hu
Applications: IHC, IHC-P
NBP1-90374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65058
Species: Hu
NBP1-03426
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-02576
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93704
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for MYO1H Antibody (NBP1-81945) (0)

There are no publications for MYO1H Antibody (NBP1-81945).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYO1H Antibody (NBP1-81945) (0)

There are no reviews for MYO1H Antibody (NBP1-81945). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MYO1H Antibody (NBP1-81945) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP1-81945

Bioinformatics Tool for MYO1H Antibody (NBP1-81945)

Discover related pathways, diseases and genes to MYO1H Antibody (NBP1-81945). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYO1H Antibody (NBP1-81945)

Discover more about diseases related to MYO1H Antibody (NBP1-81945).
 

Pathways for MYO1H Antibody (NBP1-81945)

View related products by pathway.

Blogs on MYO1H

There are no specific blogs for MYO1H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYO1H Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO1H