MYO18A Antibody - Azide and BSA Free

Western Blot: MYO18A Antibody [NBP2-93035] - Analysis of extracts of various cell lines, using MYO18A at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MYO18A Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit MYO18A Antibody - Azide and BSA Free (NBP2-93035) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1970-2054 of human MYO18A (NP_510880.2). SDVDSELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSRPRYSHSYLSDSDTEAKLTETNA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYO18A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for MYO18A Antibody - Azide and BSA Free

• KIAA0216DKFZp686L0243
• MAJN
• Molecule associated with JAK3 N-terminus
• myosin 18A
• Myosin containing a PDZ domain
• myosin containing PDZ domain
• myosin XVIIIA
• myosin-XVIIIa
• MysPDZ
• SP-A receptor subunit SP-R210 alphaS
• SPR210

Background

Myo18A/Myosin XVIIIA is an unconventional myosin that contains a lysine and glutamine (KE)-rich domain and a PDZ domain. The KE and PDZ domains appear to direct subcellular localization of the Myo18A variants. It is a dimeric actin binding protein that may play a role in the stabilization and organization of the actin cytoskeleton. Recently a cell surface form of Myo18A has been identified as the receptor for surfactant protein A, a lipid-associated lung collectin that mediates innate and adaptive immune responses in the lungs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MYO18A