MYO16 Antibody


Immunocytochemistry/ Immunofluorescence: MYO16 Antibody [NBP2-55426] - Staining of human cell line SH-SY5Y shows localization to vesicles.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

MYO16 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSASTLAQEEPYEEIIHDLPVLSSKLSPLVLPIAKQDSLLEKDIMFKDATKGLCKQQSQDSIPENPMMSGSTKPEQVKLMPPAPNDDLATL
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MYO16 Recombinant Protein Antigen (NBP2-55426PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for MYO16 Antibody

  • KIAA0865
  • MYO16 variant protein
  • Myo16b
  • myosin XVI
  • myosin-XVI
  • MYR8
  • unconventional myosin-16


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Mar, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: All-Multi
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF

Publications for MYO16 Antibody (NBP2-55426) (0)

There are no publications for MYO16 Antibody (NBP2-55426).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYO16 Antibody (NBP2-55426) (0)

There are no reviews for MYO16 Antibody (NBP2-55426). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MYO16 Antibody (NBP2-55426) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MYO16 Products

Array NBP2-55426

Bioinformatics Tool for MYO16 Antibody (NBP2-55426)

Discover related pathways, diseases and genes to MYO16 Antibody (NBP2-55426). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYO16 Antibody (NBP2-55426)

Discover more about diseases related to MYO16 Antibody (NBP2-55426).

Blogs on MYO16

There are no specific blogs for MYO16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MYO16 Antibody and receive a gift card or discount.


Gene Symbol MYO16