NYAP2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NYAP2 Antibody [NBP1-94175] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: NYAP2 Antibody [NBP1-94175] - Staining of human colon shows strong nuclear positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: NYAP2 Antibody [NBP1-94175] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoskeleton (intermediate filaments).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NYAP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PVLENVSYMKQPAGASPSTLPSHVPGHAKLEKEQAAALGPASATPALSSSPPPPSTLYRTQSPHGYPKSHSTS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NYAP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NYAP2 Protein (NBP1-94175PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NYAP2 Antibody

  • hypothetical protein LOC57624
  • KIAA1486

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5514
Species: Hu, Mu
Applications: WB
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-93806
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-09063
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-67058
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34136
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-67504
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-91266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for NYAP2 Antibody (NBP1-94175) (0)

There are no publications for NYAP2 Antibody (NBP1-94175).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NYAP2 Antibody (NBP1-94175) (0)

There are no reviews for NYAP2 Antibody (NBP1-94175). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NYAP2 Antibody (NBP1-94175) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NYAP2 Products

Array NBP1-94175

Bioinformatics Tool for NYAP2 Antibody (NBP1-94175)

Discover related pathways, diseases and genes to NYAP2 Antibody (NBP1-94175). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

PTMs for NYAP2 Antibody (NBP1-94175)

Learn more about PTMs related to NYAP2 Antibody (NBP1-94175).

Blogs on NYAP2

There are no specific blogs for NYAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NYAP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NYAP2