MYLK2 Antibody


Immunohistochemistry-Paraffin: MYLK2 Antibody [NBP2-32497] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

MYLK2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGD
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MYLK2 Protein (NBP2-32497PEP)
Read Publication using
NBP2-32497 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MYLK2 Antibody

  • EC 2.7.11
  • EC
  • KMLC
  • myosin light chain kinase 2
  • myosin light chain kinase 2, skeletal/cardiac muscle
  • skeletal muscle
  • skMLCK


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: WB, IP
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P

Publications for MYLK2 Antibody (NBP2-32497)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for MYLK2 Antibody (NBP2-32497) (0)

There are no reviews for MYLK2 Antibody (NBP2-32497). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MYLK2 Antibody (NBP2-32497) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MYLK2 Products

Bioinformatics Tool for MYLK2 Antibody (NBP2-32497)

Discover related pathways, diseases and genes to MYLK2 Antibody (NBP2-32497). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYLK2 Antibody (NBP2-32497)

Discover more about diseases related to MYLK2 Antibody (NBP2-32497).

Pathways for MYLK2 Antibody (NBP2-32497)

View related products by pathway.

PTMs for MYLK2 Antibody (NBP2-32497)

Learn more about PTMs related to MYLK2 Antibody (NBP2-32497).

Research Areas for MYLK2 Antibody (NBP2-32497)

Find related products by research area.

Blogs on MYLK2

There are no specific blogs for MYLK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MYLK2 Antibody and receive a gift card or discount.


Gene Symbol MYLK2