MYLK2 Antibody - BSA Free

Immunohistochemistry-Paraffin: MYLK2 Antibody [NBP2-32489] - Staining in human skeletal muscle and heart muscle tissues using anti-MYLK2 antibody. Corresponding MYLK2 RNA-seq data are presented for the same tissues.

Western Blot: MYLK2 Antibody [NBP2-32489] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: MYLK2 Antibody [NBP2-32489] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum.

Immunohistochemistry-Paraffin: MYLK2 Antibody [NBP2-32489] - Staining of human heart muscle shows low expression as expected.

Immunohistochemistry-Paraffin: MYLK2 Antibody [NBP2-32489] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MYLK2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MYLK2 Antibody - BSA Free (NBP2-32489) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IEFQAVPSEKSEVGQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVCTCMEKAT
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYLK2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MYLK2 Protein (NBP2-32489PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MYLK2 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.18
• KMLC
• MLCK2
• MLCK2MLCK
• MYLK2
• myosin light chain kinase 2
• myosin light chain kinase 2, skeletal/cardiac muscle
• skeletal muscle
• skMLCK

Background

MYLK2 encodes a myosin light chain kinase, a calcium/calmodulin dependent enzyme, that is exclusively expressed in adult skeletal muscle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYLK2