MYLK2 Antibody

Images

 
Western Blot: MYLK2 Antibody [NBP2-32489] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MYLK2 Antibody [NBP2-32489] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: MYLK2 Antibody [NBP2-32489] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MYLK2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IEFQAVPSEKSEVGQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVCTCMEKAT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYLK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MYLK2 Protein (NBP2-32489PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MYLK2 Antibody

  • EC 2.7.11
  • EC 2.7.11.18
  • KMLC
  • MLCK2MLCK
  • myosin light chain kinase 2
  • myosin light chain kinase 2, skeletal/cardiac muscle
  • skeletal muscle
  • skMLCK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86648
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1687
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-54719
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
NB110-38889
Species: Hu
Applications: WB, IP
AF3827
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-32489
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MYLK2 Antibody (NBP2-32489) (0)

There are no publications for MYLK2 Antibody (NBP2-32489).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYLK2 Antibody (NBP2-32489) (0)

There are no reviews for MYLK2 Antibody (NBP2-32489). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MYLK2 Antibody (NBP2-32489) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYLK2 Products

Bioinformatics Tool for MYLK2 Antibody (NBP2-32489)

Discover related pathways, diseases and genes to MYLK2 Antibody (NBP2-32489). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYLK2 Antibody (NBP2-32489)

Discover more about diseases related to MYLK2 Antibody (NBP2-32489).
 

Pathways for MYLK2 Antibody (NBP2-32489)

View related products by pathway.

PTMs for MYLK2 Antibody (NBP2-32489)

Learn more about PTMs related to MYLK2 Antibody (NBP2-32489).
 

Research Areas for MYLK2 Antibody (NBP2-32489)

Find related products by research area.

Blogs on MYLK2

There are no specific blogs for MYLK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYLK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYLK2