MYLIP Antibody

Images

 
Western Blot: MYLIP Antibody [NBP1-54903] - Titration: 0.2-1 ug/ml, Positive Control: SK-MEL-2 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MYLIP Antibody Summary

Immunogen
Synthetic peptides corresponding to MYLIP(myosin regulatory light chain interacting protein) The peptide sequence was selected from the middle region of MYLIP. Peptide sequence CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYLIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MYLIP and was validated on Western blot.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
MYLIP Protein (NBP1-54903PEP)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MYLIP Antibody

  • band 4.1 superfamily member BZF1
  • BZF1
  • cellular modulator of immune recognition (c-MIR)
  • EC 6.3.2.-
  • Idol
  • IDOLmyosin regulatory light chain-interacting protein
  • Inducible degrader of the LDL-receptor
  • MIRE3 ubiquitin-protein ligase MYLIP
  • myosin regulatory light chain interacting proteinE3 ubiquitin ligase-inducible degrader of the low density lipoprotein receptor

Background

The ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowthThe ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45867
Species: Hu
Applications: WB, Flow, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-91799
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MYLIP Antibody (NBP1-54903) (0)

There are no publications for MYLIP Antibody (NBP1-54903).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYLIP Antibody (NBP1-54903) (0)

There are no reviews for MYLIP Antibody (NBP1-54903). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYLIP Antibody (NBP1-54903) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYLIP Products

Bioinformatics Tool for MYLIP Antibody (NBP1-54903)

Discover related pathways, diseases and genes to MYLIP Antibody (NBP1-54903). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYLIP Antibody (NBP1-54903)

Discover more about diseases related to MYLIP Antibody (NBP1-54903).
 

Pathways for MYLIP Antibody (NBP1-54903)

View related products by pathway.

PTMs for MYLIP Antibody (NBP1-54903)

Learn more about PTMs related to MYLIP Antibody (NBP1-54903).
 

Research Areas for MYLIP Antibody (NBP1-54903)

Find related products by research area.

Blogs on MYLIP

There are no specific blogs for MYLIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYLIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYLIP
Uniprot