MYL7 Recombinant Protein Antigen

Images

 
There are currently no images for MYL7 Protein (NBP1-81016PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MYL7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYL7.

Source: E. coli

Amino Acid Sequence: DPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYL7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81016.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MYL7 Recombinant Protein Antigen

  • atrial isoform
  • light polypeptide 7, regulatory
  • MLC-2a
  • MYL2A
  • MYLC2AMLC2a
  • myosin, light chain 7, regulatory

Background

Myosins are a large family of motor proteins that share the common features of ATP hydrolysis, actin binding andpotential for kinetic energy transduction. Originally isolated from muscle cells (hence the name), almost alleukaryotic cells are now known to contain myosins. Structurally, mysoins contain a head domain that binds to actinfilaments (microfilaments) and is the site of ATP hydrolysis. The tail domain interacts with cargo molecules, and theneck acts as a linker between the head and tail and is the site of regulatory myosin light chain binding. There are 17myosin families and the most well characterized is myosin II. Myosin II is found predominantly in myocytes andmediates plus-ended movement along microfilaments. It is involved in muscle contraction through cyclic interactionswith actin-rich thin filaments, creating a contractile force. It is regulated by phosphorylation via myosin lightchain kinase (MLCK) and by intracellular Ca2+ concentrations.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30249
Species: Hu, Mu, Xp
Applications: ELISA, Flow, ICC/IF, IHC, WB
AF2444
Species: Hu
Applications: IHC, WB
NBP2-62625
Species: Hu
Applications: IHC,  IHC-P
AF3366
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-81555
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-89090
Species: Hu
Applications: IHC,  IHC-P
NBP1-89468
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP2-24585
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF3244
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-12910
Species: Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, MiAr, WB
NBP2-24585
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF3168
Species: Hu
Applications: ICC, WB
NBP1-83237
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB5938
Species: Hu
Applications: ICC, WB
NBP1-81016PEP
Species: Hu
Applications: AC

Publications for MYL7 Protein (NBP1-81016PEP) (0)

There are no publications for MYL7 Protein (NBP1-81016PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYL7 Protein (NBP1-81016PEP) (0)

There are no reviews for MYL7 Protein (NBP1-81016PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MYL7 Protein (NBP1-81016PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MYL7 Products

Research Areas for MYL7 Protein (NBP1-81016PEP)

Find related products by research area.

Blogs on MYL7

There are no specific blogs for MYL7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MYL7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MYL7