MYL7 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYL7. Source: E. coli Amino Acid Sequence: DPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MYL7 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81016. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for MYL7 Recombinant Protein Antigen
Background
Myosins are a large family of motor proteins that share the common features of ATP hydrolysis, actin binding andpotential for kinetic energy transduction. Originally isolated from muscle cells (hence the name), almost alleukaryotic cells are now known to contain myosins. Structurally, mysoins contain a head domain that binds to actinfilaments (microfilaments) and is the site of ATP hydrolysis. The tail domain interacts with cargo molecules, and theneck acts as a linker between the head and tail and is the site of regulatory myosin light chain binding. There are 17myosin families and the most well characterized is myosin II. Myosin II is found predominantly in myocytes andmediates plus-ended movement along microfilaments. It is involved in muscle contraction through cyclic interactionswith actin-rich thin filaments, creating a contractile force. It is regulated by phosphorylation via myosin lightchain kinase (MLCK) and by intracellular Ca2+ concentrations.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Xp
Applications: ELISA, Flow, ICC/IF, IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Fi, Hu, Pm, Mu
Applications: ELISA, ICC/IF, KD, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: AC
Publications for MYL7 Protein (NBP1-81016PEP) (0)
There are no publications for MYL7 Protein (NBP1-81016PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MYL7 Protein (NBP1-81016PEP) (0)
There are no reviews for MYL7 Protein (NBP1-81016PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for MYL7 Protein (NBP1-81016PEP) (0)
Additional MYL7 Products
Research Areas for MYL7 Protein (NBP1-81016PEP)
Find related products by research area.
|
Blogs on MYL7