MYF6 Antibody (1H3)

Images

 
Sandwich ELISA: MYF6 Antibody (1H3) [H00004618-M05] - Detection limit for recombinant GST tagged MYF6 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MYF6 Antibody (1H3) Summary

Immunogen
MYF6 (NP_002460.1, 1 a.a. - 99 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAAT
Specificity
MYF6 - myogenic factor 6 (herculin) (1H3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MYF6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MYF6 Antibody (1H3)

  • bHLHc4BHLHC4
  • Class C basic helix-loop-helix protein 4
  • MRF4
  • MRF4myogenic factor 6
  • Muscle-specific regulatory factor 4
  • myf-6
  • myogenic factor 6 (herculin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
AF6116
Species: Hu
Applications: WB, ICC
MAB7650
Species: Mu
Applications: WB, IHC
MAB1675
Species: Hu, Mu, Rt, Ch
Applications: ICC
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for MYF6 Antibody (H00004618-M05) (0)

There are no publications for MYF6 Antibody (H00004618-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYF6 Antibody (H00004618-M05) (0)

There are no reviews for MYF6 Antibody (H00004618-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYF6 Antibody (H00004618-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYF6 Products

Bioinformatics Tool for MYF6 Antibody (H00004618-M05)

Discover related pathways, diseases and genes to MYF6 Antibody (H00004618-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYF6 Antibody (H00004618-M05)

Discover more about diseases related to MYF6 Antibody (H00004618-M05).
 

Pathways for MYF6 Antibody (H00004618-M05)

View related products by pathway.

PTMs for MYF6 Antibody (H00004618-M05)

Learn more about PTMs related to MYF6 Antibody (H00004618-M05).

Blogs on MYF6

There are no specific blogs for MYF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYF6 Antibody (1H3) and receive a gift card or discount.

Bioinformatics

Gene Symbol MYF6
Entrez
Uniprot