Myeloid leukemia factor 1 Antibody

Images

 
Western Blot: Myeloid leukemia factor 1 Antibody [NBP1-53038] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Myeloid leukemia factor 1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-53038
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Myeloid leukemia factor 1 Antibody Summary

Immunogen
Synthetic peptides corresponding to MLF1(myeloid leukemia factor 1) The peptide sequence was selected from the N terminal of MLF1. Peptide sequence GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQ.
Clonality
Polyclonal
Host
Rabbit
Gene
MLF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MLF1 and was validated on Western blot.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Myeloid leukemia factor 1 Antibody

  • Myelodysplasia-myeloid leukemia factor 1
  • myeloid leukemia factor 1

Background

MLF1 is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. It interferes with erythopoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. MLF1 suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest.It binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP1-85435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03726
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77938
Species: Hu, Bv, Ca, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA
NBP1-47883
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-85436
Species: Hu
Applications: IHC, IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
28100002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for Myeloid leukemia factor 1 Antibody (NBP1-53038) (0)

There are no publications for Myeloid leukemia factor 1 Antibody (NBP1-53038).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myeloid leukemia factor 1 Antibody (NBP1-53038) (0)

There are no reviews for Myeloid leukemia factor 1 Antibody (NBP1-53038). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myeloid leukemia factor 1 Antibody (NBP1-53038) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myeloid leukemia factor 1 Products

Bioinformatics Tool for Myeloid leukemia factor 1 Antibody (NBP1-53038)

Discover related pathways, diseases and genes to Myeloid leukemia factor 1 Antibody (NBP1-53038). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myeloid leukemia factor 1 Antibody (NBP1-53038)

Discover more about diseases related to Myeloid leukemia factor 1 Antibody (NBP1-53038).
 

Pathways for Myeloid leukemia factor 1 Antibody (NBP1-53038)

View related products by pathway.

PTMs for Myeloid leukemia factor 1 Antibody (NBP1-53038)

Learn more about PTMs related to Myeloid leukemia factor 1 Antibody (NBP1-53038).
 

Research Areas for Myeloid leukemia factor 1 Antibody (NBP1-53038)

Find related products by research area.

Blogs on Myeloid leukemia factor 1

There are no specific blogs for Myeloid leukemia factor 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myeloid leukemia factor 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLF1
Uniprot