Myeloid leukemia factor 1 Antibody

Images

 
Western Blot: Myeloid leukemia factor 1 Antibody [H00004291-B01P] - Analysis of MLF1 expression in transfected 293T cell line by MLF1 polyclonal antibody. Lane1:MLF1 transfected lysate(29.48 KDa). Lane2:Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Myeloid leukemia factor 1 Antibody Summary

Immunogen
MLF1 (NP_071888.1, 1 a.a. - 268 a.a.) full-length human protein. MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MLF1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Myeloid leukemia factor 1 Antibody

  • Myelodysplasia-myeloid leukemia factor 1
  • myeloid leukemia factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP1-85435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03726
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77938
Species: Hu, Bv, Ca, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA
NBP1-47883
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-85436
Species: Hu
Applications: IHC, IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
28100002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for Myeloid leukemia factor 1 Antibody (H00004291-B01P) (0)

There are no publications for Myeloid leukemia factor 1 Antibody (H00004291-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myeloid leukemia factor 1 Antibody (H00004291-B01P) (0)

There are no reviews for Myeloid leukemia factor 1 Antibody (H00004291-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myeloid leukemia factor 1 Antibody (H00004291-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myeloid leukemia factor 1 Products

Bioinformatics Tool for Myeloid leukemia factor 1 Antibody (H00004291-B01P)

Discover related pathways, diseases and genes to Myeloid leukemia factor 1 Antibody (H00004291-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myeloid leukemia factor 1 Antibody (H00004291-B01P)

Discover more about diseases related to Myeloid leukemia factor 1 Antibody (H00004291-B01P).
 

Pathways for Myeloid leukemia factor 1 Antibody (H00004291-B01P)

View related products by pathway.

PTMs for Myeloid leukemia factor 1 Antibody (H00004291-B01P)

Learn more about PTMs related to Myeloid leukemia factor 1 Antibody (H00004291-B01P).
 

Research Areas for Myeloid leukemia factor 1 Antibody (H00004291-B01P)

Find related products by research area.

Blogs on Myeloid leukemia factor 1

There are no specific blogs for Myeloid leukemia factor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myeloid leukemia factor 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLF1
Uniprot