MYD118 Antibody - BSA Free

Western Blot: MYD118 Antibody [NBP1-58997] - Fetal Lung lysates, Antibody Dilution: 3.0 ug/ml.

Immunohistochemistry: MYD118 Antibody [NBP1-58997] - Product Page for GADD45B antibody - middle region Sample Type : Human Prostate Cancer Primary Antibody Dilution : 2 ug/mL Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue) Gene Name: GADD45B

Western Blot: MYD118 Antibody [NBP1-58997] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry: MYD118 Antibody [NBP1-58997] - Product Page for GADD45B antibody - middle region Sample Type : Human Prostate Cancer Primary Antibody Dilution : 2 ug/mL Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue) Gene Name: GADD45B

Immunohistochemistry: MYD118 Antibody [NBP1-58997] - Product Page for GADD45B antibody - middle region Sample Type : Human Prostate Cancer Primary Antibody Dilution : 2 ug/mL Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue) Gene Name: GADD45B

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MYD118 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GADD45B(growth arrest and DNA-damage-inducible, beta) The peptide sequence was selected from the middle region of GADD45B. Peptide sequence FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GADD45B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 2ug/mL
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MYD118 Antibody - BSA Free

• DKFZp566B133
• GADD45BETA
• growth arrest and DNA damage-inducible protein GADD45 beta
• growth arrest and DNA-damage-inducible, beta
• MYD118DKFZP566B133
• Myeloid differentiation primary response protein MyD118
• Negative growth regulatory protein MyD118

Background

The function of GADD45B is involved in the regulation of growth and apoptosis.This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GADD45B
• Uniprot:
  • O75293(Human)