MYCBP Antibody - Azide and BSA Free

Western Blot: MYCBP Antibody [NBP2-93175] - Analysis of extracts of various cell lines, using MYCBP antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 90s.

Immunohistochemistry-Paraffin: MYCBP Antibody [NBP2-93175] - Human thyroid cancer using MYCBP antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: MYCBP Antibody [NBP2-93175] - Human placenta using MYCBP antibody at dilution of 1:100 (40x lens).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MYCBP Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit MYCBP Antibody - Azide and BSA Free (NBP2-93175) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human MYCBP (NP_036465.2). MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYCBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:100-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000
• Theoretical MW: 11 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for MYCBP Antibody - Azide and BSA Free

• AMY-1AMY1
• Associate of Myc 1
• associate of myc-1
• c-myc binding protein
• C-Myc-binding protein
• FLJ41056

Background

The MYCBP gene encodes a protein that binds to the N-terminal region of MYC (MIM 190080) and stimulates the activation of E box-dependent transcription by MYC.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MYCBP