MYCBP Antibody


Western Blot: MYCBP Antibody [NBP1-89101] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with more
Immunocytochemistry/ Immunofluorescence: MYCBP Antibody [NBP1-89101] - Staining of human cell line A-431 shows positivity in cytoplasm and centrosome.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

MYCBP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:LVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MYCBP Protein (NBP1-89101PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MYCBP Antibody

  • AMY-1AMY1
  • Associate of Myc 1
  • associate of myc-1
  • c-myc binding protein
  • C-Myc-binding protein
  • FLJ41056


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MYCBP Antibody (NBP1-89101) (0)

There are no publications for MYCBP Antibody (NBP1-89101).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYCBP Antibody (NBP1-89101) (0)

There are no reviews for MYCBP Antibody (NBP1-89101). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MYCBP Antibody (NBP1-89101) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MYCBP Products

Bioinformatics Tool for MYCBP Antibody (NBP1-89101)

Discover related pathways, diseases and genes to MYCBP Antibody (NBP1-89101). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYCBP Antibody (NBP1-89101)

Discover more about diseases related to MYCBP Antibody (NBP1-89101).

Pathways for MYCBP Antibody (NBP1-89101)

View related products by pathway.

PTMs for MYCBP Antibody (NBP1-89101)

Learn more about PTMs related to MYCBP Antibody (NBP1-89101).

Blogs on MYCBP

There are no specific blogs for MYCBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MYCBP Antibody and receive a gift card or discount.


Gene Symbol MYCBP