MUTED Antibody

Images

 
Western Blot: MUTED Antibody [NBP2-84174] - WB Suggested Anti-MUTED Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellBLOC1S5 is supported by BioGPS gene expression data to be expressed in HeLa

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MUTED Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region MUTED. Peptide sequence: QQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAEVDEEHRKAMER The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
BLOC1S5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MUTED Antibody

  • DKFZp686E2287
  • FLJ18427
  • MUdJ303A1.3
  • muted homolog (mouse)
  • protein Muted homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45731
Species: Hu, Ca, Pm, All-NA
Applications: WB, IHC, IHC-P
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-19561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-90309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-81555
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-84174
Species: Hu
Applications: WB

Publications for MUTED Antibody (NBP2-84174) (0)

There are no publications for MUTED Antibody (NBP2-84174).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUTED Antibody (NBP2-84174) (0)

There are no reviews for MUTED Antibody (NBP2-84174). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MUTED Antibody (NBP2-84174) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MUTED Products

Bioinformatics Tool for MUTED Antibody (NBP2-84174)

Discover related pathways, diseases and genes to MUTED Antibody (NBP2-84174). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MUTED

There are no specific blogs for MUTED, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MUTED Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BLOC1S5