Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody

Images

 
Western Blot: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP2-85340] - WB Suggested Anti-CHRM1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Bladder

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human Muscarinic Acetylcholine Receptor M1/CHRM1. Peptide sequence: VKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFI The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CHRM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody

  • cholinergic receptor, muscarinic 1
  • CHRM1
  • HM1
  • M1
  • M1R
  • mAChR M1
  • MGC30125
  • muscarinic acetylcholine receptor M1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34390
Species: Hu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NLS1333
Species: Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh
Applications: IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-72961
Species: Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, WB
AF952
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
DY417
Species: Mu
Applications: ELISA
NB100-64848
Species: Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-85340
Species: Hu
Applications: WB

Publications for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP2-85340) (0)

There are no publications for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP2-85340).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP2-85340) (0)

There are no reviews for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP2-85340). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP2-85340) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Muscarinic Acetylcholine Receptor M1/CHRM1 Products

Bioinformatics Tool for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP2-85340)

Discover related pathways, diseases and genes to Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP2-85340). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP2-85340)

Discover more about diseases related to Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP2-85340).
 

Pathways for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP2-85340)

View related products by pathway.

PTMs for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP2-85340)

Learn more about PTMs related to Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP2-85340).
 

Research Areas for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP2-85340)

Find related products by research area.

Blogs on Muscarinic Acetylcholine Receptor M1/CHRM1

There are no specific blogs for Muscarinic Acetylcholine Receptor M1/CHRM1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRM1