Musashi-2 Antibody (7L4E9)

Western Blot: Musashi-2 Antibody (7L4E9) [NBP3-15935] - Western blot analysis of extracts of various cell lines, using Musashi-2 (Musashi-2) Rabbit mAb (NBP3-15935) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Immunohistochemistry-Paraffin: Musashi-2 Antibody (7L4E9) [NBP3-15935] - Immunohistochemistry of paraffin-embedded mouse brain using Musashi-2 (Musashi-2) Rabbit mAb (NBP3-15935) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Musashi-2 Antibody (7L4E9) [NBP3-15935] - Immunohistochemistry of paraffin-embedded rat brain using Musashi-2 (Musashi-2) Rabbit mAb (NBP3-15935) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 7L4E9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Musashi-2 Antibody (7L4E9) Summary

• Description: Novus Biologicals Rabbit Musashi-2 Antibody (7L4E9) (NBP3-15935) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Musashi-2 (Q96DH6). ARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPGPVADLYGPASQDSGVGNYIS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MSI2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Musashi-2 Antibody (7L4E9)

• FLJ36569
• MGC3245
• MSI2
• MSI2H
• musashi homolog 2 (Drosophila)
• Musashi2
• Musashi-2
• RNA-binding protein Musashi homolog 2

Background

Musashi 2 encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MSI2