Recombinant Human Mus81 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Mus81 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 452-549 of Human MUS81 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SLLTFSDFNAGAIKNKAQSVREVFARQLMQVRGVSGEKAAALVDRYSTPASLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRTLSQLYCSYGP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MUS81

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Mus81 Protein

  • crossover junction endonuclease MUS81
  • EC 3.1.22
  • EC 3.1.22.-
  • FLJ21012
  • FLJ44872
  • MUS81 endonuclease homolog (S. cerevisiae)
  • MUS81 endonuclease homolog (yeast)
  • SLX3 structure-specific endonuclease subunit homolog
  • SLX3

Background

MUS81 - MUS81 endonuclease homolog (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00146956-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-28680
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-58116
Species: Hu
Applications: ICC/IF
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56320
Species: Hu
Applications: WB
H00007156-R01
Species: Hu
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00080198-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Mus81 Partial Recombinant Protein (H00080198-Q01) (0)

There are no publications for Mus81 Partial Recombinant Protein (H00080198-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mus81 Partial Recombinant Protein (H00080198-Q01) (0)

There are no reviews for Mus81 Partial Recombinant Protein (H00080198-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mus81 Partial Recombinant Protein (H00080198-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mus81 Products

Bioinformatics Tool for Mus81 Partial Recombinant Protein (H00080198-Q01)

Discover related pathways, diseases and genes to Mus81 Partial Recombinant Protein (H00080198-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mus81 Partial Recombinant Protein (H00080198-Q01)

Discover more about diseases related to Mus81 Partial Recombinant Protein (H00080198-Q01).
 

Pathways for Mus81 Partial Recombinant Protein (H00080198-Q01)

View related products by pathway.

PTMs for Mus81 Partial Recombinant Protein (H00080198-Q01)

Learn more about PTMs related to Mus81 Partial Recombinant Protein (H00080198-Q01).
 

Research Areas for Mus81 Partial Recombinant Protein (H00080198-Q01)

Find related products by research area.

Blogs on Mus81

There are no specific blogs for Mus81, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Mre11 Antibody
NB100-142
Mus81 Antibody
NBP1-32054

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Mus81 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MUS81