MURF3 Antibody (2G9) - Azide and BSA Free

Western Blot: MURF3 Antibody (2G9) [H00057159-M02] - Detection against Immunogen (33.33 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2G9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MURF3 Antibody (2G9) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse MURF3 Antibody (2G9) - Azide and BSA Free (H00057159-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: TRIM54 (NP_115935, 186 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PILASQNTKIIDSELSDGIAMLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERK
• Specificity: TRIM54 (2G9)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TRIM54
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MURF3 Antibody (2G9) - Azide and BSA Free

• MuRF
• muRF3
• MURF-3
• MURFtripartite motif-containing protein 54
• Muscle-specific RING finger protein 3
• Muscle-specific RING finger protein
• RING finger protein 30muscle-specific RING-finger protein 3
• RNF30
• tripartite motif containing 54
• tripartite motif-containing 54

Background

The protein encoded by this gene contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIM54
• Entrez:
  • 57159(Human)
• OMIM:
  • 606474(Human)
• Uniprot:
  • NP_115935(Human)