MUDENG Antibody

Images

 
Immunohistochemistry: MUDENG Antibody [NBP2-33815] - Staining of human tonsil shows distinct cytoplasmic positivity in subsets of cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MUDENG Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: CPFGTLLDANLQNSLDNTNFASVTQPQKQPAWKTGTYKGKPQVSISITEKVKSMQYDKQGIADTWQVVGTVTCKCDLEGIMPNVTISLSLPT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP5M1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MUDENG Protein (NBP2-33815PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MUDENG Antibody

  • Adapter-Related Protein Complex 5 Mu Subunit
  • Adaptor-Related Protein Complex 5, Mu 1 Subunit
  • AP-5 Complex Subunit Mu
  • AP-5 Complex Subunit Mu-1
  • C14orf108
  • Chromosome 14 Open Reading Frame 108
  • MHD Domain-Containing Death-Inducing Protein
  • Mu-2 Related Death-Inducing Gene
  • Mu-2 Related Death-Inducing
  • MU-2/AP1M2 Domain Containing, Death-Inducing
  • Mu-2-Related Death-Inducing Protein
  • Mu5
  • MuD
  • Putative HIV-1 Infection-Related Protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1107
Species: Mu
Applications: WB, IHC
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-98675
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-88220
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-67605
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, ICC/IF, IF
AF3846
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-88543
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2187
Species: Hu, Mu
Applications: WB, Simple Western, IP
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-33815
Species: Hu
Applications: IHC, IHC-P

Publications for MUDENG Antibody (NBP2-33815) (0)

There are no publications for MUDENG Antibody (NBP2-33815).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUDENG Antibody (NBP2-33815) (0)

There are no reviews for MUDENG Antibody (NBP2-33815). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MUDENG Antibody (NBP2-33815) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MUDENG Products

Bioinformatics Tool for MUDENG Antibody (NBP2-33815)

Discover related pathways, diseases and genes to MUDENG Antibody (NBP2-33815). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MUDENG

There are no specific blogs for MUDENG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MUDENG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AP5M1
Uniprot