Recombinant Human MUC5B GST (N-Term) Protein

Images

 
SDS-Page: Mucin 5B Partial Protein [H00727897-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human MUC5B GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 4186-4295 of Human Mucin 5B

Source: Wheat Germ (in vitro)

Amino Acid Sequence: CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MUC5B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00727897-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MUC5B GST (N-Term) Protein

  • high molecular weight salivary mucin MG1
  • mucin 5, subtype B, tracheobronchial
  • mucin 5B, oligomeric mucus/gel-forming
  • sublingual gland mucin
  • tracheobronchial

Background

MUC5B - mucin 5, subtype B, tracheobronchial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15196
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB120-11197
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF (-), IHC, IHC-Fr,  IHC-P, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
NBP1-82045
Species: Hu
Applications: IHC,  IHC-P
H00004585-M07
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP2-44374
Species: Hu
Applications: Flow, ICC/IF, IF, IHC,  IHC-P, IP, WB
NBP2-44434
Species: Hu, Rt(-)
Applications: Flow, ICC/IF, IF, IHC,  IHC-P
DY413
Species: Mu
Applications: ELISA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
MAB59151
Species: Mu
Applications: WB
NBP2-38885
Species: Hu
Applications: IHC,  IHC-P
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
5609-MU
Species: Hu
Applications: Bind
NBP1-92450
Species: Hu
Applications: IHC,  IHC-P

Publications for MUC5B Partial Protein (H00727897-Q01)(1)

Reviews for MUC5B Partial Protein (H00727897-Q01) (0)

There are no reviews for MUC5B Partial Protein (H00727897-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MUC5B Partial Protein (H00727897-Q01). (Showing 1 - 2 of 2 FAQ).

  1. I recently bought several recombinant human mucins from your company, Mucin 4--cat# H00004585-Q01, mucin 5b--cat# H00727897-Q01, mucin 5ac--cat # H00004586-Q01. I would like to know what cell lines were used to make these recombinant proteins and whether they are glycosylated.
    • The proteins you inquired about were produced in the wheat germ protein expression system which is a cell free protein synthesis system. This system does not allow protein glycosylation. Please view more details about Abnova's cell free protein synthesis system (http://www.abnova.com/support/technologies.asp?switchfunctionid={539614B1-7CBB-4068-A93B-1B44DC6F2801})
  2. I'm interested in your company's product this human recombinant MUC5b protein. 1) Did you artificially make this from bacteria like something? 2) Your data sheet mentioned that this protein is not useful to measure activity. Is this protein composed by only core protein or is this product have glycocilation area?
    • This product is distributed by us for a Taiwanese company called Abnova. They do not test the activity of their recombinant proteins. The proteins are produced in a cell-free wheat germ system with an N-terminal 26kDa GST-tag. Due to this expression system, in our experience, the proteins do not always undergo the same folding and post-translational modifications they might undergo in an endogenous cell. Because of this, we do not recommend this protein for use in functional assays and do not guarantee them for this use. They are mainly intended for use in Western Blots as a positive control with their antibody.

Additional MUC5B Products

Research Areas for MUC5B Partial Protein (H00727897-Q01)

Find related products by research area.

Blogs on MUC5B

There are no specific blogs for MUC5B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MUC5B GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC5B