mu Opioid R/OPRM1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit mu Opioid R/OPRM1 Antibody - BSA Free (NBP1-87767) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LTLLSVSARTGFCKKQQELWQRRKEAAEALGTRKVSVLLATSHSGARPAVSTMDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCPPTGSP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
OPRM1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for mu Opioid R/OPRM1 Antibody - BSA Free
Background
The powerful effects of opiate are mediated through the opioid receptors located on the plasma membrane of neurons and other peripheral cells. There are at least 3 types of opioid receptors, mu, kappa, and delta, each with a distinct pharmacologic profile. The mu opioid receptor is the primary site of action for the most commonly used opioids, including morphine, heroin, fentanyl, and methadone.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Ch
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Publications for mu Opioid R/OPRM1 Antibody (NBP1-87767) (0)
There are no publications for mu Opioid R/OPRM1 Antibody (NBP1-87767).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for mu Opioid R/OPRM1 Antibody (NBP1-87767) (0)
There are no reviews for mu Opioid R/OPRM1 Antibody (NBP1-87767).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for mu Opioid R/OPRM1 Antibody (NBP1-87767) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional mu Opioid R/OPRM1 Products
Research Areas for mu Opioid R/OPRM1 Antibody (NBP1-87767)
Find related products by research area.
|
Blogs on mu Opioid R/OPRM1