MTX3 Antibody

Images

 
Immunohistochemistry-Paraffin: MTX3 Antibody [NBP2-14620] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTX3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SESLVVMAYAKFSGAPLKVNVIDNTWRGSRGDVPILTTEDDMVSQPG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTX3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10 - 1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MTX3 Protein (NBP2-14620PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MTX3 Antibody

  • MTX3 metaxin 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87436
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2390
Species: Hu
Applications: WB, Simple Western
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-31993
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57977
Species: Hu
Applications: WB, IHC
AF6108
Species: Hu
Applications: IHC
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB110-40424
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-14620
Species: Hu
Applications: IHC, IHC-P

Publications for MTX3 Antibody (NBP2-14620) (0)

There are no publications for MTX3 Antibody (NBP2-14620).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTX3 Antibody (NBP2-14620) (0)

There are no reviews for MTX3 Antibody (NBP2-14620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MTX3 Antibody (NBP2-14620) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTX3 Products

MTX3 NBP2-14620

Bioinformatics Tool for MTX3 Antibody (NBP2-14620)

Discover related pathways, diseases and genes to MTX3 Antibody (NBP2-14620). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTX3 Antibody (NBP2-14620)

Discover more about diseases related to MTX3 Antibody (NBP2-14620).
 

Pathways for MTX3 Antibody (NBP2-14620)

View related products by pathway.

Blogs on MTX3

There are no specific blogs for MTX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTX3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTX3