Recombinant Human MTR Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MTR Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1094 - 1203 of Human MTR partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MTR
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MTR Protein

  • 5-methyltetrahydrofolate-homocysteine methyltransferase 1
  • 5-methyltetrahydrofolate-homocysteine methyltransferase
  • cblG
  • cobalamin-dependent methionine synthase
  • EC 2.1.1.13
  • FLJ33168
  • FLJ43216,5-methyltetrahydrofolate--homocysteine methyltransferase
  • FLJ45386
  • methionine synthase
  • MS
  • Vitamin-B12 dependent methionine synthase

Background

MTR - 5-methyltetrahydrofolate-homocysteine methyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP1-57749
Species: Hu
Applications: WB, IHC
H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF7895
Species: Hu
Applications: WB, IHC
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-82612
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02349
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for MTR Partial Recombinant Protein (H00004548-Q01) (0)

There are no publications for MTR Partial Recombinant Protein (H00004548-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTR Partial Recombinant Protein (H00004548-Q01) (0)

There are no reviews for MTR Partial Recombinant Protein (H00004548-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTR Partial Recombinant Protein (H00004548-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTR Products

Bioinformatics Tool for MTR Partial Recombinant Protein (H00004548-Q01)

Discover related pathways, diseases and genes to MTR Partial Recombinant Protein (H00004548-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTR Partial Recombinant Protein (H00004548-Q01)

Discover more about diseases related to MTR Partial Recombinant Protein (H00004548-Q01).
 

Pathways for MTR Partial Recombinant Protein (H00004548-Q01)

View related products by pathway.

PTMs for MTR Partial Recombinant Protein (H00004548-Q01)

Learn more about PTMs related to MTR Partial Recombinant Protein (H00004548-Q01).
 

Research Areas for MTR Partial Recombinant Protein (H00004548-Q01)

Find related products by research area.

Blogs on MTR

There are no specific blogs for MTR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MTR Blocking Peptide
NBP1-79285PEP
CBS Antibody (3E1.)
H00000875-M01
MTR Antibody
NB100-791
ACAT1 Antibody
NBP1-89285

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MTR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MTR