MTH1 Recombinant Protein Antigen

Images

 
There are currently no images for MTH1 Recombinant Protein Antigen (NBP2-54664PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MTH1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTH1

Source: E. coli

Amino Acid Sequence: RWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NUDT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54664.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MTH1 Recombinant Protein Antigen

  • 8-oxo-7,8-dihydrodeoxyguanosine triphosphatase
  • 8-oxo-dGTPase
  • EC 3.6.1.-
  • EC 3.6.1.56
  • MTH1
  • MTH1Nucleoside diphosphate-linked moiety X motif 1
  • mutT human homolog 1,8-oxo-dGTPase
  • nucleoside diphosphate-linked moiety X-type motif 17,8-dihydro-8-oxoguanine triphosphatase
  • nudix (nucleoside diphosphate linked moiety X)-type motif 1,8-oxo-7,8-dihydroguanosine triphosphatase
  • Nudix motif 1
  • NUDT1

Background

Oxygen radicals damage chromosomal DNA causing cell death and inducing mutations. Among the various classes of DNA damage caused by oxygen radicals, an oxidized form of guanine base (8-oxoguanine) appears to be important as it can pair with cytosine and adenine and G:C to T:A transversion mutation occurs. A significant amount of 8-OxoG is formed in the chromosomal DNA of mammalian cells, with most damaged nucleotides excised from the DNA and excreted in the urine. Along with 8-oxoG being present in oxidatively damaged DNA, 8-oxo-deoxyguanosine (8-oxo-dGTP) is formed in the nucleotide pool during normal cellular metabolism and following oxidative stress. The 8-oxo-dGTP nucleotide can be incorporated in DNA during polymerization and can result in a mispairing unless repaired. MTH converts 8-oxo-dGTP in the nucleotide pool to the monophosphate and prevents the misincorporation of 8-oxo-dGTP into DNA (Figure courtesy of Dr. Mark Kelley). MTH also recognizes 8-oxo-rGTP, which could incorporate into RNA during gene transcription leading to missense or nonsense protein production.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-106
Species: Hu, Mu, Po, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
H00004595-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
AF3168
Species: Hu
Applications: ICC, WB
NBP3-07211
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-93605
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-83131
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-108
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF4885
Species: Mu
Applications: IP, WB
AF3880
Species: Hu
Applications: ICC, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
NBP2-47358
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-54664PEP
Species: Hu
Applications: AC

Publications for MTH1 Recombinant Protein Antigen (NBP2-54664PEP) (0)

There are no publications for MTH1 Recombinant Protein Antigen (NBP2-54664PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTH1 Recombinant Protein Antigen (NBP2-54664PEP) (0)

There are no reviews for MTH1 Recombinant Protein Antigen (NBP2-54664PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MTH1 Recombinant Protein Antigen (NBP2-54664PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTH1 Products

Research Areas for MTH1 Recombinant Protein Antigen (NBP2-54664PEP)

Find related products by research area.

Blogs on MTH1.

MTH1: Effects on DNA Damage Repair, Cancer and Neurodegeneration
MTH1 (human MutT Homolog 1) is a purine nucleoside triphosphatase enzyme and belongs to the Nudix hydrolase family. In mammalian systems, MTH is a major detoxifier of the oxidized DNA precursors, 8-oxo-dGTP, 8-oxo-dATP, and 2-OH-dATP and prevents the ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MTH1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDT1